
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Sequence | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2 |
Sequence (3 Letter) | H-Asp-Ala-Glu-Phe-Gly-His-Asp-Ser-Gly-Phe-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Lys(Biotin)-NH2 |
Molecular Weight | 4587.3 |
Properties | |
Purity | > 95% By HPLC |
Storage | Store at -20 °C, cap vial tightly at all times. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.