Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Beta - Amyloid (11 - 40), mouse, rat
| Overview | |
|---|---|
| Description | This is amino acids 11 to 40 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid fragment by one amino acid residue: His13 in human beta-amyloid corresponds to Arg13 in mice and rat sequence. |
| Sequence | EVRHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Sequence (3 Letter) | H-Glu-Val-Arg-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH |
| Molecular Weight | 3170.7 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Wang, R. et al. J. Biol. Chem. 271, 31894 (1996); Kowalik-Jankowska,T. et al. J. Inorg. Chem. 92, 1 (2002).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.