Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Beta - Amyloid (40 - 1), Human
| Overview | |
|---|---|
| Sequence | VVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
| Sequence (3 Letter) | H-Val-Val-Gly-Gly-Val-Met-Leu-Gly-Ile-Ile-Ala-Gly-Lys-Asn-Ser-Gly-Val-Asp-Glu-Ala-Phe-Phe-Val-Leu-Lys-Gln-His-His-Val-Glu-Tyr-Gly-Ser-Asp-His-Arg-Phe-Glu-Ala-Asp-OH |
| Molecular Weight | 4329.9 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.