Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Amylin, human, amide
| Overview | |
|---|---|
| Synonyms | Diabetes-Associated Peptide (DAP), amide, humanInsulinoma or islet amyloid polypeptide (IAPP) |
| Description | Amylin, a 37-amino acid polypeptide that is structurally related to calcitonin, is secreted from the B cells of the pancreas. Amylin has anoretic effects in rats. Amylin may be responsible for the etiology of insulin resistance of type II diabetes mellitus through its modulation of peripheral effects of insulin. Amylin blocks the activation of glycogen synthase by insulin. |
| Cas No | 122384-88-7 |
| Sequence | {LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}{HIS}{SER}{SER}{ASN}{ASN}{PHE}{GLY}{ALA}{ILE}{LEU}{SER}{SER}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2 |
| Sequence Shortening | KCNTATCATQRLANFLVHSSNNFGAILSSTNVGSNTY-NH2 |
| Molecular Formula | C165H261N51O55S2 |
| C Terminal | NH2 |
| Disulfide Bridge | Disulfide Bridge: Cys2-Cys7 |
| Molecular Weight | 3903.28 |
| Properties | |
| Purity | > 95% |
| Format Bridge | 2-7 |
| Solubility | Can be dissolved in DMSO or DMF first and then dilute with water |
| Storage | Store at -20°C. Keep container tightly closed. Store in a cool dry place. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.