
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Synonyms | Amylin (8-37), amide; amylin pharmaceuticals; muraglitazar; oxyntomodulin; symlinDiabetes Associated Peptide (8-37), amide |
Description | Amylin is a 37-aa peptide produced in the pancreatic beta-cell secretory granules and Amylin is co-released with insulin. Amylin has specific binding sites in the CNS and Amylin may regulate gastric emptying and influence carbohydrate metabolism. |
Sequence | {ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}{ARG}{SER}{SER}{ASN}{ASN}{LEU}{GLY}{PRO}{VAL}{LEU}{PRO}{PRO}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR}-NH2 |
Sequence Shortening | ATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 |
Molecular Formula | C140H227N43O43 |
C Terminal | NH2 |
Molecular Weight | 3200.6 |
Properties | |
Purity | > 95% |
Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weight out a smaller portion of the contents. |
Gmp Flag | 0 |
Storage | Store at -20°C. Keep tightly closed. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.