Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Amylin, amide, rat
| Overview | |
|---|---|
| Description | Amylin is a peptide that displays 50% homology with calcitonin gene-related peptide (CGRP), Amylin is colocalized with somatostatin in endocrine cells of the gastric fundus. In isolated mouse stomach, amylin caused a concentration-dependent decrease in acid secretion. In rat fundic segments, amylin and CGRP each caused a concentration-dependent increase in somatostatin and a decrease in histamine secretion. |
| Sequence | {LYS}{CYS}{ASN}{THR}{ALA}{THR}{CYS}{ALA}{THR}{GLN}{ARG}{LEU}{ALA}{ASN}{PHE}{LEU}{VAL}{ARG}{SER}{SER}{ASN}{ASN}{LEU}{GLY}{PRO}{VAL}{LEU}{PRO}{PRO}{THR}{ASN}{VAL}{GLY}{SER}{ASN}{THR}{TYR} |
| Sequence Shortening | KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY-NH2 |
| Molecular Formula | C167H272N52O53S2 |
| C Terminal | NH2 |
| Disulfide Bridge | Disulfide bridge: Cys2-Cys7 |
| Molecular Weight | 3920.5 |
| Properties | |
| Purity | > 95% |
| Format Bridge | 2-7 |
| Solubility | Can be dissolved in water directly |
| Gmp Flag | 0 |
| Storage | Store at -20°C. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.