Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

Iberiotoxin (IbTX)
Pyr - FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bridge: 7 - 28, 13 - 33, 17 - 35)

Product Code: 3282-0010

Price: $139.00

Available Options

* Package Size:
- +
Overview
Description

A 37-amino acid peptide from the scorpion, Buthus tamulus, having 68% homology with charybdotoxin. It is a selective inhibitor of the highly conductance calcium-activated (maxi-K) potassium channels.

Sequence Pyr-FTDVDCSVSKECWSVCKDLFGVDRGKCMGKKCRCYQ(Disulfide bridge: 7-28,13-33,17-35)
Sequence (3 Letter) Pyr - Phe - Thr - Asp - Val - Asp - Cys - Ser - Val - Ser - Lys - Glu - Cys - Trp - Ser - Val - Cys - Lys - Asp - Leu - Phe - Gly - Val - Asp - Arg - Gly - Lys - Cys - Met - Gly - Lys - Lys - Cys - Arg - Cys - Tyr - Gln - OH (Disulfide: 7-28,13-33,17-35)
Molecular Weight 4230.9
Properties
Purity % Peak Area By HPLC ≥ 95%
Storage -20 °C

Galvez, A. et al. J. Biol. Chem. 265, 11083 (1990). Candia, S. et al. Biophys. J. 63, 583 (1992).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.