
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | Charybdotoxin (ChTX) is a Ca2+-activated K+ channel blocker. It depolarizes peripheral T lymphocytes and blocks their mitogen-induced proliferation. ChTX is a highly basic peptide isolated from venom of the scorpion, Leiurus quinquestriatus hebraeus. |
Sequence | Pyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7-28, 13-33 and 17-35) |
Sequence (3 Letter) | Pyr - Phe - Thr - Asn - Val - Ser - Cys - Thr - Thr - Ser - Lys - Glu - Cys - Trp - Ser - Val - Cys - Gln - Arg - Leu - His - Asn - Thr - Ser - Arg - Gly - Lys - Cys - Met - Asn - Lys - Lys - Cys - Arg - Cys - Tyr - Ser - OH (Disulfide: 7-28,13-33,17-35) |
Molecular Weight | 4296 |
Properties | |
Purity | % Peak Area By HPLC ≥ 95% |
Storage | -20 °C |
Ref: Leonard, R. et al. Proc. Natl. Acad. Sci. USA 89, 10094 (1992); Gimenez-Gallego, Proc. Natl. Acad. Sci. USA 85, 3329 (1988). Sugg, E. et al. J. Biol. Chem. 265, 18745 (1990).
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.