Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

Charybdotoxin
Pyr - FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7 - 28, 13 - 33, 17 - 35)

Product Code: 3283-0010

Price: $150.00

Available Options

* Package Size:
- +
Overview
Description

Charybdotoxin (ChTX) is a Ca2+-activated K+ channel blocker. It depolarizes peripheral T lymphocytes and blocks their mitogen-induced proliferation. ChTX is a highly basic peptide isolated from venom of the scorpion, Leiurus quinquestriatus hebraeus.

Sequence Pyr-FTNVSCTTSKECWSVCQRLHNTSRGKCMNKKCRCYS (Disulfide bridge: 7-28, 13-33 and 17-35)
Sequence (3 Letter) Pyr - Phe - Thr - Asn - Val - Ser - Cys - Thr - Thr - Ser - Lys - Glu - Cys - Trp - Ser - Val - Cys - Gln - Arg - Leu - His - Asn - Thr - Ser - Arg - Gly - Lys - Cys - Met - Asn - Lys - Lys - Cys - Arg - Cys - Tyr - Ser - OH (Disulfide: 7-28,13-33,17-35)
Molecular Weight 4296
Properties
Purity % Peak Area By HPLC ≥ 95%
Storage -20 °C

Ref: Leonard, R. et al. Proc. Natl. Acad. Sci. USA 89, 10094 (1992); Gimenez-Gallego, Proc. Natl. Acad. Sci. USA 85, 3329 (1988). Sugg, E. et al. J. Biol. Chem. 265, 18745 (1990).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.