Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
TIP 39, Tuberoinfundibular Neuropeptide
SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP
| Overview | |
|---|---|
| Description | This is a tuberoinfundibular neuropeptide and parathyroid hormone 2(PTH 2)-receptor agonist from hypothalmus. Synthetic TIP39 activates human and rat PTH2 receptors. |
| Sequence | SLALADDAAFRERARLLAALERRHWLNSYMHKLLVLDAP |
| Sequence (3 Letter) | H - Ser - Leu - Ala - Leu - Ala - Asp - Asp - Ala - Ala - Phe - Arg - Glu - Arg - Ala - Arg - Leu - Leu - Ala - Ala - Leu - Glu - Arg - Arg - His - Trp - Leu - Asn - Ser - Tyr - Met - His - Lys - Leu - Leu - Val - Leu - Asp - Ala - Pro - OH |
| Molecular Weight | 4504.3 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
Ref: Usdin, TB. et al. Nat. Am. 2, 941 (1999); Piserchio, A. et al. J. Biol. Chem. 275, 27284 (2000).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.