
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Sequence | Biotin-SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
Sequence (3 Letter) | Biotin - Ser - Val - Ser - Glu - Ile - Gln - Leu - Met - His - Asn - Leu - Gly - Lys - His - Leu - Asn - Ser - Met - Glu - Arg - Val - Glu - Trp - Leu - Arg - Lys - Lys - Leu - Gln - Asp - Val - His - Asn - Phe - OH |
Molecular Weight | 4344.1 |
Properties | |
Purity | % Peak Area By HPLC ≥ 95% |
Storage | -20 °C |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.