Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!
Product Code: 1033-001

Price: $162.00

Available Options

* Package Size:
- +
Overview
Description This is amino acids 721 to 770 fragment of the amyloid precursor protein resulting from the g-secretase cleavage of the C-terminus of beta-amyloid precursor protein (APP) at Leu720-Val721. This peptide is also known as CTF50-99. The mutation at Leu723 (L723P) causes familial Alzheimer €™s disease.
Sequence VMLKKKQYTSIHHGVVEVDAAVTPEERHLSKMQQNGYENPTYKFFEQMQN
Sequence (3 Letter) H-Val-Met-Leu-Lys-Lys-Lys-Gln-Tyr-Thr-Ser-Ile-His-His-Gly-Val-Val-Glu-Val-Asp-Ala-Ala-Val-Thr-Pro-Glu-Glu-Arg-His-Leu-Ser-Lys-Met-Gln-Gln-Asn-Gly-Tyr-Glu-Asn-Pro-Thr-Tyr-Lys-Phe-Phe-Glu-Gln-Met-Gln-Asn-OH
Molecular Weight 5910.7
Properties
Purity > 95% By HPLC
Storage Store at -20 °C, cap vial tightly at all times.
Gu, Y., et al. J. Biol. Chem. 276, 35235 (2001); Kwok, J. et al. Ann. Neurol. 47, 249 (2000).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.