InnoPep Products Filter

Filter by categories

New Products
Peptides
- Adhesion Peptides
- Adrenomedullin and Related Peptides
- Amylin (IAPP) and Fragments
- Angiotensins and Fragments
- Anti-Bacterials
- Anti-Inflammatory Peptides
- Anti-Neoplastics
- Anti-Virals
- Antimicrobial and Antiviral Peptides
- Apoptosis Peptides
- Bacterial Peptides
- Bcl-BAD Peptides
- Bombesins and Antagonists
- Bradykinins and Bradykinin-Potentiating Peptides
- C3a Peptides
- Cancer Research Peptides
- Cardiovascular Related Peptides
- Caspase Related Peptides
- CEF Control Peptides
- Cell Permeable Peptides (CPP) - Drug Delivery Peptides
- Cellular Antigens
- Chemotaxis Fators and Related Peptides
- Corticotropin-Releasing Factor (CRF) and Analogs
- Defensins
- DNA-Binding Peptides
- Endocrine and hormonal
- Endorphins
- Endothelins and Related Peptides
- Enkephalins
- Enzyme Substrates and Inhibitors
- Exendins and Fragments
- Extracellular Matrix
- Fibrinogen and Related Peptides
- Fibronectin Fragments and Analogs
- Fluorescent Labeled Peptides
- FRET Peptides
- Gastric Inhibitory Peptide (GIP) and Fragments
- GPCR Peptide Ligands
- Growth Factors and Fragments
- Guanylin and Uroguanylin
- Hepatitis C Virus (HCV) Related Peptides
- Histone Sequences
- HIV Related Peptides
- Integrins
- Ion Channel Peptides
- Kinases - Phosphatase Substrates
- Luteinizing Hormone-Releasing Hormones and Related Peptides
- Matrix Metalloproteinase (MMP) Inhibitors and Substrates
- Melan-A and Mucin Related Peptides
- Melanocyte Stimulating Hormones and Analogs
- MHC Related Peptides
- Microbial Peptides
- Myelin Oligodendrocyte Glycoprotein (MOG)--Myelin Basic Proteins (MBP)
- Myosin
- Natriuretic Peptides
- Nesfatins
- Neurogranin
- Neurological
- Neuropeptides
- NF-kB - Transcription Factors Related Peptides
- Nuclear Rc
- Orexins
- Osteocalcin and Fragments
- OVA Peptides
- p53 Peptides
- Pancreatic Polypeptides (PP)
- Parathyroid Hormones (PTH) and Related Peptides
- Phosphopeptides
- Phytochelatins
- Prion Protein (PrP) Fragments
- Protease Inhibitors
- Protein Phosphorylation Related Peptides
- Renin Inhibitors and Substrates
- Retinoid Binding Protein
- RGD Peptides
- Saposin Related Peptides
- Signal Transduction Peptides
- Spexin
- Tag Peptides
- Tau Peptides
- Thrombin Related Peptides
- Thrombospondins
- Toxins
- Tubulin Peptides
- Viral Peptides

Filter by keyword...:

Natriuretic Peptides

Neurogranin

Nesfatins

Nesfatin - 1 (24 - 53), human  <span class="textboldred">NEW

Nesfatin - 1 (24 - 53), human NEW

PDTGLYYDEYLKQVIDVLETDKHFREKLQK-NH2

$165.00

View Details

Nesfatin - 1 (24 - 53), mouse  <span class="textboldred">NEW

Nesfatin - 1 (24 - 53), mouse NEW

PDTGLYYDEYLKQVIEVLETDPHFREKLQK-NH2

$165.00

View Details

Shopping Cart

InnoPep Products Filter

Nesfatins

Nesfatin - 1 (24 - 53), human NEW

Nesfatin - 1 (24 - 53), mouse NEW

About InnoPep

Products & Services

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.

Search