Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Nesfatin - 1 (24 - 53), human NEW
| Overview | |
|---|---|
| Description | Nesfatin-1 was recently identified as an anorexigenic peptide and is derived from Nucleobindin2 protein. Nesfatin-1 reduces body weight gain, food and water intake in rodents. In humans high levels of Nesfatin-1 in plasma are associated with overweight individuals. In addition, Nesfatin-1 has been linked to anxiety and stress. |
| Sequence | PDTGLYYDEYLKQVIDVLETDKHFREKLQK-NH2 |
| Sequence (3 Letter) | Pro - Asp - Thr - Gly - Leu - Tyr - Tyr - Asp - Glu - Tyr - Leu - Lys - Gln - Val - Ile - Asp - Val - Leu - Glu - Thr - Asp - Lys - His - Phe - Arg - Glu - Lys - Leu - Gln - Lys - NH2 |
| Molecular Weight | 3685.3 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | €“20 °C |
1. Feijóo-Bandín S., et.al., Endocrinology 154 (12), 4757-4767 (2013)
2. Vas S., et.al., PLOS 8 (4), 1-10 (2013)
3. Ramanjaneya M., et.al., Endocrinology 151 (7), 3169-3180 (2010)
2. Vas S., et.al., PLOS 8 (4), 1-10 (2013)
3. Ramanjaneya M., et.al., Endocrinology 151 (7), 3169-3180 (2010)
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.