
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | This is a N-terminus fluorescent (FAM)-labeled and C-terminus biotinylated Galanin peptide, Abs/Em=494/521nm. |
Sequence | FAM-GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin) |
Sequence (3 Letter) | FAM-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-Lys(Biotin)-OH |
Molecular Weight | 3870.2 |
Properties | |
Purity | > 95% By HPLC |
Storage | Store at -20 °C, cap vial tightly at all times. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.