Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Galanin - Lys(Biotin), human
| Overview | |
|---|---|
| Description | Biotin is attached to the epsilon group of the extra lysine added to the C-terminus of this Galanin. |
| Sequence | GWTLNSAGYLLGPHAVGNHRSFSDKNGLTSK(Biotin) |
| Sequence (3 Letter) | H-Gly-Trp-Thr-Leu-Asn-Ser-Ala-Gly-Tyr-Leu-Leu-Gly-Pro-His-Ala-Val-Gly-Asn-His-Arg-Ser-Phe-Ser-Asp-Lys-Asn-Gly-Leu-Thr-Ser-Lys(Biotin)-OH |
| Molecular Weight | 3511.9 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.