Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

Endocrine and hormonal


Show:
Sort By:
Growth Hormone Releasing Factor, GRF (1 - 44), amide, bovine

YADAIFTNSYRKVLGQLSARKLLQDIMNRQQGERNQEQGAKVRL-NH2

$174.00

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.