Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Growth Hormone Releasing Factor, GRF (1 - 29), amide, human
| Overview | |
|---|---|
| Description | This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. |
| Sequence | YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 |
| Sequence (3 Letter) | H-Tyr-Ala-Asp-Ala-Ile-Phe-Thr-Asn-Ser-Tyr-Arg-Lys-Val-Leu-Gly-Gln-Leu-Ser-Ala-Arg-Lys-Leu-Leu-Gln-Asp-Ile-Met-Ser-Arg-NH2 |
| Molecular Weight | 3357.9 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Ref: Ling, N. et al. Proc. Natl. Acad. Sci. USA 81, 4302 (1984); Gaudreau, P. et al. J. Med. Chem. 35, 1864 (1992); Zarandi, VA. et al. Biochem. Biophys. Res. Commun. 119, 265 (1984); Lapierre, H. et al. Domest. Anim. Endocrinol. 4, 207 (1987); Mayo, KE. et al. Nature 306, 86 (1983); Pinski, J. et al. Peptide Protein Res. 41, 707 (1993).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.