Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Anti - BetaGamma (MPS - Phosducin - like protein C terminus)
AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE
| Overview | |
|---|---|
| Description | This is a membrane-permeable phosphoducin-like anti-βγ peptide, whose membrane-permeable sequence (MPS) is derived from the C-terminal residues of phosducin-like protein (PhLP). This region of PhLP has been shown to confer interactions with Gβϒ-mediated signaling. Specifically, it was shown to have inhibitory effects on Go GTPase activity, demonstrating the ability to bind Gβγ, and inhibition of Gβγ-enhanced rhodopsin phosphorylation by βARK. The PhLP shares amino acid sequence homology with phosphoducin, a phosphoprotein expressed in the retina and pineal gland. These proteins have been shown to regulate G-protein signaling by binding to the beta-gamma subunits of G proteins. |
| Sequence | AAVALLPAVLLALLAVTDQLGEDFFAVDLEAFLQEFGLLPEKE |
| Sequence (3 Letter) | H - Ala - Ala - Val - Ala - Leu - Leu - Pro - Ala - Val - Leu - Leu - Ala - Leu - Leu - Ala - Val - Thr - Asp - Gln - Leu - Gly - Glu - Asp - Phe - Phe - Ala - Val - Asp - Leu - Glu - Ala - Phe - Leu - Gln - Glu - Phe - Gly - Leu - Leu - Pro - Glu - Lys - |
| Molecular Weight | 4601.4 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
1, Orr, A. et al. J. Biol. Chem. 277, 20453 (2002)
2, Chang M. et al. J Biol Chem. 275:7021-7029 (2000).
2, Chang M. et al. J Biol Chem. 275:7021-7029 (2000).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.