
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | Cecropin B is a small antibacterial peptide from the giant silkmoth, Hyalophora cecropia. Antimicrobial peptides are essential to innate host defense as effectors of pathogen clearance and can affect host cell to promote wound repair. |
Sequence | KWKVFKKIEKMGRNIRNGIVKAGPAIAVLGEAKAL-NH2 |
Sequence (3 Letter) | H-Lys-Trp-Lys-Val-Phe-Lys-Lys-Ile-Glu-Lys-Met-Gly-Arg-Asn-Ile-Arg-Asn-Gly-Ile-Val-Lys-Ala-Gly-Pro-Ala-Ile-Ala-Val-Leu-Gly-Glu-Ala-Lys-Ala-Leu-NH2 |
Molecular Weight | 3834.7 |
Properties | |
Purity | > 95% By HPLC |
Storage | Store at -20 °C, cap vial tightly at all times. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.