Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Cecropin A
| Overview | |
|---|---|
| Description | Cecropin A is a naturally occurring, linear, cationic, 37-residue antimicrobial peptide. Cecropin A kills bacteria by dissipating transmembrane electrochemical ion-gradients. |
| Sequence | KWKLFKKIEKVGQNIRDGIIKAGPAVAVVGQATQIAK-NH2 |
| Sequence (3 Letter) | H-Lys-Trp-Lys-Leu-Phe-Lys-Lys-Ile-Glu-Lys-Val-Gly-Gln-Asn-Ile-Arg-Asp-Gly-Ile-Ile-Lys-Ala-Gly-Pro-Ala-Val-Ala-Val-Val-Gly-Gln-Ala-Thr-Gln-Ile-Ala-Lys-NH2 |
| Molecular Weight | 4003.8 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Ref: Silvestro, L. et al. Biophysical J. 72, A195 (1997); Andreu, D. et al. Proc. Natl. Acad. Sci. USA 80, 6475 (1983); Silvestro, L. et al. Biochem. 36, 11452 (1997).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.