Call Now: +1 858 800 3101 Email: info@innopep.com
| Overview | |
|---|---|
| Description | PACAP (6-38) is a potent antagonist of PACAP 38. PACAP (6-38) is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27-stimulated pituitary adenylate cyclase. Ki values for the inhibition of the enzyme were 7nM and 150 nM, respectively. PACAP (6-38) caused a small but significant (approximately 20%) inhibition of the NANC relaxation due to electrical field stimulation (1 Hz or 10 Hz for 20 s). At these frequencies PACAP (6-38) caused no inhibition of the NANC relaxation in the presence of the P2 purinoceptor antagonist pyridoxal-phosphate-6-azophenyl-2',4'-disulphonic acid (or PPADS) plus the NO-synthase blocker NG-nitro-L-arginine; in preparations pretreated with L-NOARG alone, PACAP (6-38) retained its inhibitory effect. | 
| Sequence | {PHE}{THR}{ASP}{SER}{TYR}{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}{GLY}{LYS}{ARG}{TYR}{LYS}{GLN}{ARG}{VAL}{LYS}{ASN}{LYS}-NH2 | 
| Sequence Shortening | FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 | 
| Molecular Formula | C182H300N56O45S1 | 
| C Terminal | NH2 | 
| Molecular Weight | 4024.76 | 
| Properties | |
| Purity | > 95% | 
| Solubility | Soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. | 
| Gmp Flag | 0 | 
| Storage | Store the peptide at -20°C. | 
| Note | This peptide is a potent agonist. | 
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.