
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | PACAP (1-38), a novel neuropeptide isolated from the bovine hypothalamus is more active than vasoactive intestinal peptide (VIP) in stimulating adenylate cyclase (EC50=7 nM). PACAP 1-38 (10-9 M) increased substance P (SP), gastrin releasing peptide (GRP), and VIP release. PACAP 1-38 (10-8 M) inhibited gastrin secretion and stimulated somatostatin secretion and motility dose-dependently. |
Cas No | 137061-48-4 |
Sequence | {HIS}{SER}{ASP}{GLY}{ILE}{PHE}{THR}{ASP}{SER}{TYR}{SER}{ARG}{TYR}{ARG}{LYS}{GLN}{MET}{ALA}{VAL}{LYS}{LYS}{TYR}{LEU}{ALA}{ALA}{VAL}{LEU}{GLY}{LYS}{ARG}{TYR}{LYS}{GLN}{ARG}{VAL}{LYS}{ASN}{LYS}-NH2 |
Sequence Shortening | HSDGIFTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 |
Molecular Formula | C203H331N63O53S1 |
C Terminal | NH2 |
Molecular Weight | 4534.26 |
Properties | |
Purity | > 95% |
Solubility | The peptide is soluble in water. The contents of this vial have been accurately determined. Both the stopper and the vial have been siliconized. Do not attempt to weigh out a smaller portion of the contents. |
Storage | Store the peptide at -20°C. |
Note | PACAP stimulates adenylate cyclase in rat anterior pituitary cells. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.