
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | Removing endogenously bound CaM by titration with a high affinity (pM) CaM-binding peptide derived from smooth muscle myosin light-chain kinase (MLCK peptide) strongly inhibited IP3-induced Ca2+ release. This inhibition was concentration- and time-dependent. |
Sequence | {GLY}{VAL}{MET}{PRO}{ARG}{GLU}{GLU}{THR}{ASP}{SER}{LYS}{THR}{ALA}{SER}{PRO}{TRP}{LYS}{SER}{ALA}{ARG}{LEU}{MET}{VAL}{HIS}{THR}{VAL}{ALA}{THR}{PHE}{ASN}{SER}{ILE}{LYS}{GLU}{LEU}{ASN}{GLU}{ARG}{TRP}{ARG}{SER}{LEU}{GLN}{GLN}{LEU}{ALA} |
Sequence Shortening | GVMPREETDSKTASPWKSARLMVHTVATFNSIKELNERWRSLQQLA |
Molecular Formula | C231H373N69O70S2 |
Molecular Weight | 5301.01 |
Properties | |
Purity | > 95% |
Gmp Flag | 0 |
Storage | Store at -20°C. Keep tightly closed. Store in a cool dry place. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.