Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
β-Amyloid (42-1)
| Overview | |
|---|---|
| Synonyms | βAmyloid; b-Amyloid; bAmyloid; beta-Amyloid; betaAmyloidβ-Amyloid |
| Description | Beta amyloid (42-1) is the reverse of beta amyloid (1-42), the latter is a member of beta amyloid-peptides, which are involved in the amyloid beta-peptide (A beta)-associated free radical oxidative stress model for neuronal death in Alzheimer's disease (AD) brain. |
| Sequence | {ALA}{ILE}{VAL}{VAL}{GLY}{GLY}{VAL}{MET}{LEU}{GLY}{ILE}{ILE}{ALA}{GLY}{LYS}{ASN}{SER}{GLY}{VAL}{ASP}{GLU}{ALA}{PHE}{PHE}{VAL}{LEU}{LYS}{GLN}{HIS}{HIS}{VAL}{GLU}{TYR}{GLY}{SER}{ASP}{HIS}{ARG}{PHE}{GLU}{ALA}{ASP} |
| Sequence Shortening | AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD |
| Molecular Formula | C203H311N55O60S1 |
| Molecular Weight | 4514.4 |
| Properties | |
| Purity | > 95% |
| Gmp Flag | 0 |
| Storage | Store at -20°C. Keep tightly closed. Store in a cool dry place. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.