Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
β-Amyloid (1-42), rat
| Overview | |
|---|---|
| Synonyms | Abeta 1-42, ratβ-Amyloid Peptide; βAmyloid Peptide; b-Amyloid Peptide; bAmyloid Peptide; beta-Amyloid Peptide; betaAmyloid Peptide |
| Description | Abeta 1-42 induces a strong membrane destabilization in giant unilamellar vesicles composed of palmitoyloleoyl-phosphatidylcholine, sphingomyelin, and cholesterol, lowering the critical tension of vesicle rupture. Additionally, Abeta 1-42 triggers the induction of sequential leakage of low- and high-molecular-weight markers trapped inside the giant unilamellar vesicles, but preserving the vesicle shape. The Abeta 1-42 sequence confers particular molecular properties to the peptide that, in turn, influence supramolecular properties associated with membranes that may result in toxicity,including: 1) the ability of the peptide to strongly associate with the membrane; 2) a reduction of lateral membrane cohesive forces; and 3) a capacity to break the transbilayer gradient and puncture sealed vesicles. |
| Sequence | {ASP}{ALA}{GLU}{PHE}{GLY}{HIS}{ASP}{SER}{GLY}{PHE}{GLU}{VAL}{ARG}{HIS}{GLN}{LYS}{LEU}{VAL}{PHE}{PHE}{ALA}{GLU}{ASP}{VAL}{GLY}{SER}{ASN}{LYS}{GLY}{ALA}{ILE}{ILE}{GLY}{LEU}{MET}{VAL}{GLY}{GLY}{VAL}{VAL}{ILE}{ALA} |
| Sequence Shortening | DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
| Molecular Formula | C199H307N53O59S1 |
| Molecular Weight | 4418.1 |
| Properties | |
| Purity | > 95% |
| Gmp Flag | 0 |
| Storage | Store at -20°C. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.