Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Tau Peptide (306 - 336) (Repeat 3 domain)
VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ
| Overview | |
|---|---|
| Description | TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer €™s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat (3R) or four repeat (R4) domains, in addition to the presence or absence of one or two insert domains at the amino-terminus (see figure below). Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain. RELATED PRODUCTS:Tau Peptide (45-73) (Exon 2/Insert 1 domain)Tau Peptide (74-102) (Exon 3/Insert 2 domain)Tau Peptide (244-274) (Repeat 1 domain) Tau Peptide (275-305) (Repeat 2 domain)Tau Peptide (337-368) (Repeat 4 domain) |
| Sequence | VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ |
| Sequence (3 Letter) | Val - Gln - Ile - Val - Tyr - Lys - Pro - Val - Asp - Leu - Ser - Lys - Val - Thr - Ser - Lys - Cys - Gly - Ser - Leu - Gly - Asn - Ile - His - His - Lys - Pro - Gly - Gly - Gly - Gln - OH |
| Molecular Weight | 3248 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
Buee, L. et al. Brain Res Rev 33 95 (2000).
Trinczek, B. et al. Mol Biol Cell 6, 1887 (1995).
Trinczek, B. et al. Mol Biol Cell 6, 1887 (1995).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.