Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
3 x Hemagglutinin (HA) Tag
| Overview | |
|---|---|
| Description | This tag peptide may be used to detect proteins and peptides, and to facilitate functional analysis of proteins of interest. |
| Sequence | MEYPYDVPDYAAEYPYDVPDYAAEYPYDVPDYAAKLE |
| Sequence (3 Letter) | H-Met-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Glu-Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala-Ala-Lys-Leu-Glu-OH |
| Molecular Weight | 4372.7 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Kang, Y. et al. J. Biol. Chem. 281, 19019 (2006).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.