
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | Parathyroid hormone (PTH) regulates the metabolism of calcium and phosphate. PTH and PTH-related polypeptide (PTHrP) play important roles in calcium homeostasis of bone, kidney, breast, and placenta; they signal via the PTH/PTHrP and PTH2 receptors. PTH(1 €“34) administration suppresses cardiovascular calcification and down-regulates aortic osteogenic programs driven by diabetes and dyslipidemia. |
Sequence | SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNF |
Sequence (3 Letter) | H - Ser - Val - Ser - Glu - Ile - Gln - Leu - Met - His - Asn - Leu - Gly - Lys - His - Leu - Asn - Ser - Met - Glu - Arg - Val - Glu - Trp - Leu - Arg - Lys - Lys - Leu - Gln - Asp - Val - His - Asn - Phe - OH |
Molecular Weight | 4117.8 |
Properties | |
Purity | % Peak Area By HPLC ≥ 95% |
Storage | -20 °C |
Ref: Shao, J. et al. J. Biol. Chem. 278, 50195 (2003); Shew, RL. and PKT. Pang Peptides 5, 485 (1984).
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.