Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Urocotin III; Stresscopin (SCP) (3 - 40), mouse
| Overview | |
|---|---|
| Description | Urocortin III is a 38 amino acid peptide that is a member of the Corticotropin-Releasing Factor (CRF) family of peptides. Studies show that Urocortin III is highly selective for the Corticotropin-Releasing Factor 2 (CRF2) receptor and does not show affinity for the CRF binding protein. |
| Sequence | FTLSLDVPTNIMNILFNIDKAKNLRAKAAANAQLMAQI-NH2 |
| Sequence (3 Letter) | H-Phe-Thr-Leu-Ser-Leu-Asp-Val-Pro-Thr-Asn-Ile-Met-Asn-Ile-Leu-Phe-Asn-Ile-Asp-Lys-Ala-Lys-Asn-Leu-Arg-Ala-Lys-Ala-Ala-Ala-Asn-Ala-Gln-Leu-Met-Ala-Gln-Ile-NH2 |
| Molecular Weight | 4173 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.