
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | The degree of amino-terminal truncation varies in different neuritic plaque extractions; however, in studies of several Down €™s syndrome patients subjected to neuritic plaque extraction, Aßs 1-42, 1-40, 3-42, 4-42, 5-42, 8-42, and 9-42 have been identified. |
Sequence | SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA |
Sequence (3 Letter) | H-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-Ile-Ala-OH |
Molecular Weight | 3643.2 |
Properties | |
Purity | > 95% By HPLC |
Storage | Store at -20 °C, cap vial tightly at all times. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.