Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Beta - Amyloid (8 - 40)
| Overview | |
|---|---|
| Description | This peptide is b-Amyloid 8 to 40 amino acids fragment. Angiotensin-converting enzyme (ACE) genotype has been shown to be associated with Alzheimer's disease (AD) in some populations. ACE degrades b-Amyloid by cleaving ß-?Amyloid 1 to 40 between Asp7-Ser8. Compared with b-Amyloid 1 to 40, aggregation and cytotoxic effects of the degradation products b-Amyloid 1 to 7 and b-Amyloid 8 to 40 peptides are reduced or virtually absent. |
| Sequence | SGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Sequence (3 Letter) | H-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH |
| Molecular Weight | 3459 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Hu, J. et al. J. Biol. Chem. 276, 47863 (2001).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.