Call Now: +1 858 800 3101 Email: info@innopep.com
| Overview | |
|---|---|
| Description | This is amino acids 5 to 40 fragment of the beta-amyloid peptide. This amino-truncated amyloid peptide produced from caspase-cleaved amyloid precursor protein is deposited in Alzheimer €™s disease brain. Cleavage between Phe4 and Arg5 is not mediated by BACE1. |
| Sequence | RHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Sequence (3 Letter) | H-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH |
| Molecular Weight | 3867.4 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.