Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Beta - Amyloid (1 - 40), FAM - labeled
| Overview | |
|---|---|
| Description | This is a fluorescent (FAM)-labeled ß-Amyloid (1-40), Abs/Em=494/521 nm. FAM is preferred over FITC because of its photo- and chemical stability. |
| Sequence | FAM-DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV |
| Sequence (3 Letter) | FAM-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Gly-Ala-Ile-Ile-Gly-Leu-Met-Val-Gly-Gly-Val-Val-OH |
| Molecular Weight | 4688.2 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Ref: Prior, R. et al. Am. J. Pathol. 148, 1749 (1996).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.