Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Beta - Amyloid (1 - 28) - Lys(Biotin) - NH2
| Overview | |
|---|---|
| Description | This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine. |
| Sequence | DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2 |
| Sequence (3 Letter) | H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Lys(Biotin)-NH2 |
| Molecular Weight | 3616 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.