Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

Beta - Amyloid (1 - 28) - Lys(Biotin) - NH2

Product Code: 1041-005

Price: $208.00

Available Options

* Package Size:
- +
Overview
Description This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.
Sequence DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
Sequence (3 Letter) H-Asp-Ala-Glu-Phe-Arg-His-Asp-Ser-Gly-Tyr-Glu-Val-His-His-Gln-Lys-Leu-Val-Phe-Phe-Ala-Glu-Asp-Val-Gly-Ser-Asn-Lys-Lys(Biotin)-NH2
Molecular Weight 3616
Properties
Purity > 95% By HPLC
Storage Store at -20 °C, cap vial tightly at all times.

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.