Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!
Product Code: 3245-0100

Price: $187.00

Available Options

* Package Size:
- +
Overview
Description This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium.
Sequence KSKKAVWHKLLSKQRRRAVVACFRMTPLYN
Sequence (3 Letter) H - Lys - Ser - Lys - Lys - Ala - Val - Trp - His - Lys - Leu - Leu - Ser - Lys - Gln - Arg - Arg - Arg - Ala - Val - Val - Ala - Cys - Phe - Arg - Met - Thr - Pro - Leu - Tyr - Asn - OH
Molecular Weight 3616.4
Properties
Purity % Peak Area By HPLC ≥ 95%
Storage -20 °C
Kovaks, E. et al. J Biol Chem 285, 1799 (2010).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.