Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | This peptide is amino acids 3614 to 3643 fragment of Ryanodine receptor 1 (RyR1), also known as calmodulin binding peptide (CaMBP), belonging to a class of intracellular calcium channels. It is the major cellular mediator of calcium-induced calcium release (CICR) in animal cells. The ryanodine receptor is itself activated by cytosolic calcium. |
Sequence | KSKKAVWHKLLSKQRRRAVVACFRMTPLYN |
Sequence (3 Letter) | H - Lys - Ser - Lys - Lys - Ala - Val - Trp - His - Lys - Leu - Leu - Ser - Lys - Gln - Arg - Arg - Arg - Ala - Val - Val - Ala - Cys - Phe - Arg - Met - Thr - Pro - Leu - Tyr - Asn - OH |
Molecular Weight | 3616.4 |
Properties | |
Purity | % Peak Area By HPLC ≥ 95% |
Storage | -20 °C |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.