Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!
Product Code: 3339-0100

Price: $247.00

Available Options

* Package Size:
- +
Overview
Description This synthetic peptide mimics wild-type AH (amphipathic helix) and inhibits membrane association of NS5A, hence impairing HCV replication.
Sequence SGSWLRDVWDWICTVLTDFKTWLQSKLDYKD-NH2
Sequence (3 Letter) Ser - Gly - Ser - Trp - Leu - Arg - Asp - Val - Trp - Asp - Trp - Ile - Cys - Thr - Val - Leu - Thr - Asp - Phe - Lys - Thr - Trp - Leu - Gln - Ser - Lys - Leu - Asp - Tyr - Lys - Asp - NH2
Molecular Weight 3805.3
Properties
Purity % Peak Area By HPLC ≥ 95%
Storage -20 °C
Ref: Glenn, JS. et al. J. Virol. 77, 6055 (2003).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.