Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

Pramlintide, Acetate [Pro25, 28, 29] - Amylin(1 - 37), human, Amide

Product Code: 1492-005

Price: $181.00

Available Options

* Package Size:
- +
Overview
Description Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide €™s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
Sequence (3 Letter) H-Lys-Cys-Asn-Thr-Ala-Thr-Cys-Ala-Thr-Gln-Arg-Leu-Ala-Asn-Phe-Leu-Val-His-Ser-Ser-Asn-Asn-Phe-Gly-Pro-Ile-Leu-Pro-Pro-Thr-Asn-Val-Gly-Ser-Asn-Thr-Tyr-NH2 acetate salt (S-S Bond)
Molecular Weight 3949.5
Properties
Purity > 95% By HPLC
Storage Store at -20 °C, cap vial tightly at all times.
McQueen, J. Am. J. Health-System Pharmacy 62 2363 (2005).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.