Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Peptide YY, human
| Overview | |
|---|---|
| Description | PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent. |
| Sequence | YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2 |
| Sequence (3 Letter) | H-Tyr-Pro-Ile-Lys-Pro-Glu-Ala-Pro-Gly-Glu-Asp-Ala-Ser-Pro-Glu-Glu-Leu-Asn-Arg-Tyr-Tyr-Ala-Ser-Leu-Arg-His-Tyr-Leu-Asn-Leu-Val-Thr-Arg-Gln-Arg-Tyr-NH2 |
| Molecular Weight | 4309.8 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Ref: Tatemoto, K. et al. BBRC 157, 713 (1988); Halldén, G. and G. Aponte, J. Biol. Chem. 272, 12591 (1997); Murphy, KG. and SR. Bloom, Exp. Physiol. 89, 507 (2004); Batterham, R. et al. Nature 418, 650 (2002); Gribble, F. et al. Diabetes 52,1147 (2003); Batterham, R. et al. N. Engl. J. Med. 349, 941 (2003).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.