
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | This peptide is a potent antagonist of PACAP 38 and is much more potent and selective than PACAP (6-27) in the inhibition of PACAP-27 stimulated pituitary adenylate cyclase. The Ki values for the inhibition of the enzyme are 7nM and 150 nM, respectively. |
Sequence | FTDSYSRYRKQMAVKKYLAAVLGKRYKQRVKNK-NH2 |
Sequence (3 Letter) | H-Phe-Thr-Asp-Ser-Tyr-Ser-Arg-Tyr-Arg-Lys-Gln-Met-Ala-Val-Lys-Lys-Tyr-Leu-Ala-Ala-Val-Leu-Gly-Lys-Arg-Tyr-Lys-Gln-Arg-Val-Lys-Asn-Lys-NH2 |
Molecular Weight | 4024.8 |
Properties | |
Purity | > 95% By HPLC |
Storage | Store at -20 °C, cap vial tightly at all times. |
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.