Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!

Neuropeptide F

Product Code: 1597-005

Price: $225.00

Available Options

* Package Size:
- +
Overview
Description Neuropeptide F (NPF), found in Drosophila is a homolog of the mammalian Neuropeptide Y.
Sequence PDKDFIVNPSDLVLDNKAALRDYLRQINEYFAIIGRPRF-NH2
Sequence (3 Letter) H-Pro-Asp-Lys-Asp-Phe-Ile-Val-Asn-Pro-Ser-Asp-Leu-Val-Leu-Asp-Asn-Lys-Ala-Ala-Leu-Arg-Asp-Tyr-Leu-Arg-Gln-Ile-Asn-Glu-Tyr-Phe-Ala-Ile-Ile-Gly-Arg-Pro-Arg-Phe-NH2
Molecular Weight 4593.3
Properties
Purity > 95% By HPLC
Storage Store at -20 °C, cap vial tightly at all times.
Ref: Wen, T. et al. Proc. Natl. Acad. Sci. USA 102, 2141 (2005).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.