
Call Now: +1 858 800 3101 Email: info@innopep.com
Overview | |
---|---|
Description | Glucagon-like peptide-1 (GLP-1) is an incretin derived from the transcription product of the proglucagon gene. The major source of GLP-1 in the body is the intestinal L cell that secretes GLP-1 as a gut hormone. Its physiological functions include promoting insulin sensitivity, decreasing food intake by increasing satiety in brain and increasing insulin secretion from the pancreas in a glucose-dependent manner. |
Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRG |
Sequence (3 Letter) | H-His-Ala-Glu-Gly-Thr-Phe-Thr-Ser-Asp-Val-Ser-Ser-Tyr-Leu-Glu-Gly-Gln-Ala-Ala-Lys-Glu-Phe-Ile-Ala-Trp-Leu-Val-Lys-Gly-Arg-Gly-OH |
Molecular Weight | 3355.7 |
Properties | |
Purity | > 95% By HPLC |
Storage | Store at -20 °C, cap vial tightly at all times. |
Ref: Brubaker, P. and D. Drucker, Receptors Channels 8, 179 (2002); Leonova, J. et al. Am. J. Physiol. Cell Physiol. 281, C1495 (2001); Drucker, D. et al. Proc. Natl. Acad. Sci. USA 84, 3434 (1987); Rönnbäck, L. and E. Hansson, J. Neuroinflam. 1, 22 (2004); Rothstein JD. et al. Neuron. 16, 675 (1996); Sonnewald, U. et al. Pharmacol. 3011 (2002).
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.