Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Gastrin Releasing Peptide, human
| Overview | |
|---|---|
| Description | Gastrin-releasing peptide, a 27-amino acid peptide isolated from the gut, shares a common C-terminal decapeptide homology with bombesin. Gastrin-releasing peptide is an important growth-modulating factor in developing lung epithelium. It is used as a tumor marker in the diagnosis of small-cell lung carcinoma, since it is known to be produced by these cancer cells. |
| Sequence | VPLPAGGGTVLTKMYPRGNHWAVGHLM-NH2 |
| Sequence (3 Letter) | H-Val-Pro-Leu-Pro-Ala-Gly-Gly-Gly-Thr-Val-Leu-Thr-Lys-Met-Tyr-Pro-Arg-Gly-Asn-His-Trp-Ala-Val-Gly-His-Leu-Met-NH2 |
| Molecular Weight | 2859.4 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Ref: Kamata, K. et al. Nephrol. Dialysis Transplantation 11, 1267 (1996); Tache, Y. et al. Gastroenterol. 81, 298 (1981); Siegfried, J. et al. J. Biol. Chem. 269, 8596 (1994); Patel, O. et al. Biochem. Pharmacol. 68, 2129 (2004).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.