Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!
Product Code: 1490-001

Price: $82.00

Available Options

* Package Size:
- +
Overview
Description AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
Sequence (3 Letter) H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2
Molecular Weight 3576
Properties
Purity > 95% By HPLC
Storage Store at -20 °C, cap vial tightly at all times.
Ref: Hyvelin, JM. et al. J. Card Surg. 17, 328 (2002); Ziolkowska, A. et al. Int. J. Mol. Med. 11, 613 (2003); Nishimatsu, H. et al. Hypertens. Res. 26 Suppl, S79 (2003).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.