Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Adrenomedullin (22 - 52), human
| Overview | |
|---|---|
| Description | AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist. |
| Sequence | TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2 |
| Sequence (3 Letter) | H-Thr-Val-Gln-Lys-Leu-Ala-His-Gln-Ile-Tyr-Gln-Phe-Thr-Asp-Lys-Asp-Lys-Asp-Asn-Val-Ala-Pro-Arg-Ser-Lys-Ile-Ser-Pro-Gln-Gly-Tyr-NH2 |
| Molecular Weight | 3576 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Ref: Hyvelin, JM. et al. J. Card Surg. 17, 328 (2002); Ziolkowska, A. et al. Int. J. Mol. Med. 11, 613 (2003); Nishimatsu, H. et al. Hypertens. Res. 26 Suppl, S79 (2003).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.