Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
ACTH (7 - 38), human
| Overview | |
|---|---|
| Description | Corticotropin-inhibiting peptide (CIP), the 7-38 fragment of human ACTH (1-39), is known to act as an antagonist of ACTH receptors. It does not have any corticosteroidogenic activity. |
| Sequence | FRWGKPVGKKRRPVKVYPNGAEDESAEAFPLE |
| Sequence (3 Letter) | H-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-OH |
| Molecular Weight | 3659.2 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Ref: Malendowicz, L. et al. J. Steroid Biochem. Mol. Biol. 67, 149 (1998); Li, CH. et al. Proc. Natl. Acad. Sci. USA 75, 4306 (1978)
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.