Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
ACTH (1 - 39), human
| Overview | |
|---|---|
| Sequence | SYSMEHFRWGKPVGKKRRPVKVYPNGAEDESAEAFPLEF |
| Sequence (3 Letter) | H-Ser-Tyr-Ser-Met-Glu-His-Phe-Arg-Trp-Gly-Lys-Pro-Val-Gly-Lys-Lys-Arg-Arg-Pro-Val-Lys-Val-Tyr-Pro-Asn-Gly-Ala-Glu-Asp-Glu-Ser-Ala-Glu-Ala-Phe-Pro-Leu-Glu-Phe-OH |
| Molecular Weight | 4541.1 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Ref: Grazzini, E. et al. Proc. Natl. Acad. Sci. USA 101, 7175 (2004), Donald, RA. Clin. Endocrinol. 12, 491 (1980); Pepper, GM. et al. Cell. Immun. 151, 110 (1993).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.