Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Exendin (5 - 39)
TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS - NH2
| Overview | |
|---|---|
| Description | This truncated Exendin-4 peptide, Exendin (5-39) amide, is a potent Glucagon-Like Peptide 1 (GLP-1) receptor antagonist. Unlike the full length Exendin-4 (a GLP-1 agonist), Exendin (5-39) antagonizes GLP-1 €“stimulated insulin release after food intake. |
| Sequence | TFTSDLSKQMEEEAVRLFIEWLKNGGPSSGAPPPS-NH2 |
| Sequence (3 Letter) | H - Thr - Phe - Thr - Ser - Asp - Leu - Ser - Lys - Gln - Met - Glu - Glu - Glu - Ala - Val - Arg - Leu - Phe - Ile - Glu - Trp - Leu - Lys - Asn - Gly - Gly - Pro - Ser - Ser - Gly - Ala - Pro - Pro - Pro - Ser - NH2 |
| Molecular Weight | 3806.3 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.