Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
β - Endorphin, human
YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
| Overview | |
|---|---|
| Sequence | YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE |
| Sequence (3 Letter) | H - Tyr - Gly - Gly - Phe - Met - Thr - Ser - Glu - Lys - Ser - Gln - Thr - Pro - Leu - Val - Thr - Leu - Phe - Lys - Asn - Ala - Ile - Ile - Lys - Asn - Ala - Tyr - Lys - Lys - Gly - Glu - OH |
| Molecular Weight | 3465.1 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.