Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
Corticotropin Releasing Factor, CRF, human, rat
SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII - NH2
| Overview | |
|---|---|
| Sequence | SEEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII-NH2 |
| Sequence (3 Letter) | H - Ser - Glu - Glu - Pro - Pro - Ile - Ser - Leu - Asp - Leu - Thr - Phe - His - Leu - Leu - Arg - Glu - Val - Leu - Glu - Met - Ala - Arg - Ala - Glu - Gln - Leu - Ala - Gln - Gln - Ala - His - Ser - Asn - Arg - Lys - Leu - Met - Glu - Ile - Ile - NH2 |
| Molecular Weight | 4757.5 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.