Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
OVA (241 - 270)
| Overview | |
|---|---|
| Description | This peptide is OVA peptide residues 241 to 270. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC). |
| Sequence | SMLVLLPDEVSGLEQLESIINFEKLTEWTS |
| Sequence (3 Letter) | H-Ser-Met-Leu-Val-Leu-Leu-Pro-Asp-Glu-Val-Ser-Gly-Leu-Glu-Gln-Leu-Glu-Ser-Ile-Ile-Asn-Phe-Glu-Lys-Leu-Thr-Glu-Trp-Thr-Ser-OH |
| Molecular Weight | 3421.9 |
| Properties | |
| Purity | > 95% By HPLC |
| Storage | Store at -20 °C, cap vial tightly at all times. |
Mareeva, T. et al. J Biol Chem 279, 44243 (2004).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.