Call Now: +1 858 800 3101 Email: info@innopep.com


Your shopping cart is empty!
Product Code: 1990-005

Price: $141.00

Available Options

* Package Size:
- +
Overview
Description This peptide is OVA peptide residues 241 to 270. OVA Peptide is a class I (Kb)-restricted peptide epitope of ovalbumin presented by the class I MHC (major histocompatibility complex) molecule, H-2Kb (class I genes of the mouse MHC).
Sequence SMLVLLPDEVSGLEQLESIINFEKLTEWTS
Sequence (3 Letter) H-Ser-Met-Leu-Val-Leu-Leu-Pro-Asp-Glu-Val-Ser-Gly-Leu-Glu-Gln-Leu-Glu-Ser-Ile-Ile-Asn-Phe-Glu-Lys-Leu-Thr-Glu-Trp-Thr-Ser-OH
Molecular Weight 3421.9
Properties
Purity > 95% By HPLC
Storage Store at -20 °C, cap vial tightly at all times.
Mareeva, T. et al. J Biol Chem 279, 44243 (2004).

About InnoPep

InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.

Newsletter Signup

Stay Updated With Our Latest Products.

Your email is safe with us, we don't spam.