Call Now: +1 858 800 3101 Email: info@innopep.com
Shopping Cart
0 Item(s) - $0.00
Your shopping cart is empty!
TAT - NSF700scr
YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL
| Overview | |
|---|---|
| Description | This scrambled human immunodeficiency virus (HIV) transactivator of transcription (TAT) N-ethylmaleimide-sensitive factor (NSF) 700scr peptide is used as a control peptide to TAT-NSF700 peptide. It does not inhibit the disassembly activity of NSF in contrast to the TAT-NSF700 which plays a critical role in regulating exocytosis. |
| Sequence | YGRKKRRQRRRGGGIPPVYFSRLDLNLVVLLLAQL |
| Sequence (3 Letter) | H - Tyr - Gly - Arg - Lys - Lys - Arg - Arg - Gln - Arg - Arg - Arg - Gly - Gly - Gly - Ile - Pro - Pro - Val - Tyr - Phe - Ser - Arg - Leu - Asp - Leu - Asn - Leu - Val - Val - Leu - Leu - Leu - Ala - Gln - Leu - OH |
| Molecular Weight | 4109.9 |
| Properties | |
| Purity | % Peak Area By HPLC ≥ 95% |
| Storage | -20 °C |
Morrell, C. et al. JPET 314, 155 (2005).
About InnoPep
InnoPep Inc. is a company started by a couple of researchers with decades of expertise in peptide synthesis and conjugation aimed at enabling.